Em formação

7.25F: Purificando Proteínas por Tag de Afinidade - Biologia


Os marcadores de proteínas são sequências de peptídeos geneticamente enxertadas em uma proteína recombinante.

objetivos de aprendizado

  • Indique o uso de tags de afinidade de proteína

Pontos chave

  • As etiquetas de afinidade são anexadas às proteínas para que possam ser purificadas de sua fonte biológica bruta usando uma técnica de afinidade.
  • Proteínas recombinantes que carregam pequenos marcadores de afinidade são eficientemente expressas em bactérias, insetos ou células de mamíferos.
  • Após a lise celular e eliminação do lisado, as proteínas marcadas são purificadas usando um procedimento de cromatografia de afinidade com metal imobilizado.

Termos chave

  • proteína: As proteínas são grandes moléculas biológicas que consistem em uma ou mais cadeias de aminoácidos.
  • afinidade: Uma força atrativa entre átomos, ou grupos de átomos, que contribui para a formação de suas ligações.
  • recombinante: Este termo se refere a algo formado pela combinação de elementos existentes em uma nova combinação. Assim, a frase DNA recombinante se refere a um organismo criado em laboratório pela adição de DNA de outra espécie.

Os marcadores de proteínas são sequências de peptídeos geneticamente enxertadas em uma proteína recombinante. Freqüentemente, essas marcas são removíveis por agentes químicos ou por meios enzimáticos, como proteólise ou splicing de inteína. As marcas são anexadas às proteínas para vários fins.

As etiquetas de afinidade são anexadas às proteínas para que possam ser purificadas de sua fonte biológica bruta usando uma técnica de afinidade. Estes incluem a proteína de ligação à quitina (CBP), a proteína de ligação à maltose (MBP) e a glutationa-S-transferase (GST). A etiqueta poli (His) é uma etiqueta de proteína amplamente utilizada; ele se liga a matrizes metálicas.

Etiquetas de solubilização são utilizadas, especialmente para proteínas recombinantes expressas em espécies deficientes em chaperonas, como E. coli, de modo a auxiliar no dobramento adequado das proteínas e evitar que elas precipitem. Estes incluem tioredoxina (TRX) e poli (NANP). Algumas tags de afinidade têm um papel duplo como agente de solubilização, como MBP e GST.

As marcas de cromatografia são usadas para alterar as propriedades cromatográficas da proteína para permitir uma resolução diferente em uma técnica de separação particular. Muitas vezes consistem em aminoácidos polianiônicos, como FLAG-tag.

Os marcadores de epítopo são sequências peptídicas curtas que são escolhidas porque os anticorpos de alta afinidade podem ser produzidos de forma confiável em muitas espécies diferentes. Geralmente são derivados de genes virais, o que explica sua alta imunorreatividade. As tags de epítopo incluem tag V5, tag c-myc e tag HA. Essas marcas são particularmente úteis para experiências de western blotting, imunofluorescência e imunoprecipitação, embora também encontrem uso na purificação de anticorpos.

Etiquetas de fluorescência são usadas para fornecer leitura visual de uma proteína. GFP e suas variantes são as tags de fluorescência mais comumente usadas. Aplicações mais avançadas de GFP incluem usá-lo como um repórter dobrável (fluorescente se dobrado, incolor se não).

Os marcadores de proteína também são úteis para modificação enzimática específica (como marcadores de biotina ligase) e marcador de modificação química (FlAsH). Freqüentemente, os marcadores são combinados para produzir modificações multifuncionais da proteína. No entanto, com a adição de cada tag, existe o risco de que a função nativa da proteína seja abolida ou comprometida pelas interações com a tag.

Exemplos de tags de peptídeos incluem:

  • AviTag, um peptídeo que permite a biotinilação pela enzima BirA e assim a proteína pode ser isolada pela estreptavidina (GLNDIFEAQKIEWHE)
  • Tag de calmodulina, um peptídeo ligado pela proteína calmodulina (KRRWKKNFIAVSAANRFKKISSSGAL)
  • FLAG-tag, um peptídeo reconhecido por um anticorpo (DYKDDDDK)
  • HA-tag, um peptídeo reconhecido por um anticorpo (YPYDVPDYA)
  • His-tag, 5-10 histidinas ligadas por um quelato de níquel ou cobalto (HHHHHH)
  • Myc-tag, um peptídeo curto reconhecido por um anticorpo (EQKLISEEDL)
  • S-tag (KETAAAKFERQHMDS)
  • SBP-tag, um peptídeo que se liga a estreptavidina (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP)
  • Softag 1, para expressão em mamíferos (SLAELLNAGLGGS)
  • Softag 3, para expressão procariótica (TQDPSRVG)
  • Tag V5, um peptídeo reconhecido por um anticorpo (GKPIPNPLLGLDST)
  • Tag Xpress (DLYDDDDK)

Exemplos de etiquetas de proteína incluem:

  • BCCP (Biotin Carboxyl Carrier Protein), um domínio de proteína reconhecido pela estreptavidina
  • Glutationa-S-transferase-tag, uma proteína que se liga à glutationa imobilizada
  • Tag de proteína fluorescente verde, uma proteína que é espontaneamente fluorescente e pode ser ligada por nanocorpos
  • Tag da proteína de ligação à maltose, uma proteína que se liga à amilose agarose
  • Nus-tag
  • Strep-tag, um peptídeo que se liga à estreptavidina ou à estreptavidina modificada chamada estreptactina (Strep-tag II: WSHPQFEK)
  • Tag tiorredoxina

Comparação de tags de afinidade para purificação de proteínas

Tags de afinidade são ferramentas altamente eficientes para purificar proteínas de extratos brutos. Para facilitar a seleção de tags de afinidade para projetos de purificação, comparamos a eficiência de oito tags de afinidade elutáveis ​​para purificar proteínas de Escherichia coli, fermento, Drosófilae extratos de HeLa. Nossos resultados mostram que as tags de peptídeo HIS, CBP, CYD (peptídeo NorpD covalente porém dissociável), Strep II, FLAG, HPC (cadeia pesada da proteína C) e os sistemas de tag de fusão de proteína GST e MBP diferem substancialmente em pureza, rendimento, e custo. Descobrimos que a marca HIS fornece bons rendimentos de proteína marcada a partir de resinas de alta capacidade e baratas, mas com pureza apenas moderada de E. coli extratos e purificação relativamente pobre de fermento, Drosófilae extratos de HeLa. A tag CBP produziu proteína de pureza moderada de E. coli, fermento e Drosófila extratos, mas melhor pureza dos extratos HeLa. Etiquetas baseadas em epítopos, como FLAG e HPC, produziram a proteína de maior pureza para todos os extratos, mas requerem resina cara e de baixa capacidade. Nossos resultados sugerem que a tag Strep II pode fornecer um compromisso aceitável de purificação excelente com bons rendimentos a um custo moderado.


Ferramentas de nanotecnologia para o estudo de RNA

2.2.2 Funcionalização por meio de ligação covalente

Em alguns casos, a imobilização de moléculas alvo por meio de ligação covalente é preferida. Aqui, explicamos várias abordagens.

A proteína de marca pequena que pode se ligar ao ligante ortogonal é útil. Vários tipos de tal proteína tag estão disponíveis comercialmente (por exemplo, Halo-tag e SNAP-tag). O Halo-tag é desenvolvido a partir da haloalcano desalogenase bacteriana para formar uma ligação covalente com o ligante sintético. 126 As haloalcano desalogenases de tipo selvagem removem haletos de hidrocarbonetos alifáticos por um mecanismo de deslocamento nucleofílico. E uma ligação covalente é formada durante a catálise entre um aspartato na enzima e o substrato de hidrocarboneto. A mutação em um sítio ativo levou a fixar esse intermediário, mantendo uma ligação covalente entre a proteína Halo-tag e seu ligante. O tamanho do Halo-tag é de cerca de 33 kDa (297 aminoácidos, Fig. 7 A) com o peu de 4,9. SNAP-tag foi desenvolvido por Johnsson e colegas de trabalho. 127 Eles desenvolveram a proteína SNAP-tag a partir da proteína de reparo do DNA humano O-6-alquilguanina-DNA alquiltransferase (hAGT), que transfere irreversivelmente o grupo alquil de seu substrato, O-6-alquilguanina-DNA, para um de seus resíduos de cisteína. Dada a especificidade do substrato de hAGT é relativamente baixa e semelhante O-6-benzilguanina (BG) também é aceita como substrato, eles otimizaram o substrato e fizeram mutagênese para obter SNAP-tag (Fig. 7 B). SNAP-tag é uma proteína ligeiramente menor de 20 kDa (182 aminoácidos) com o peu de 6,0. Niemeyer e colegas exploraram a capacidade de ligação do Halo-tag e do SNAP-tag ao origami de DNA. 128 Eles descobriram que o peu de proteína afeta o rendimento de ocupação: em média 35 e 60% para a proteína de fusão Halo-tag e proteína de fusão SNAP-tag, respectivamente. Usando SNAP-tag, imobilização direta de proteínas motoras dineína em origami de DNA foi relatada. 58

Figura 7. Funcionalização da nanoestrutura de DNA por ligação covalente. (A) Proteína Halo-tag (297 aminoácidos, 33 kDa) e seu substrato. (B) proteína com etiqueta SNAP (182 aminoácidos, 20 kDa) e seu substrato. (C, topo) Química de clique convencional, onde alcino e azida reagem para formar um triazol por meio da reação catalisada por cobre (I) de Huisgen-Sharpless-Meldal, que é conveniente, mas interfere na formação da nanoestrutura de DNA através do potencial Mg 2+ -Cu 2+ substituição e requer reagentes auxiliares perigosos para a reação. (abaixo) Química de clique livre de cobre, em que a azida reage com alcinos deformados, como ciclooctenos. A velocidade de reação lenta (10–100 M / s) é a desvantagem da reação de clique sem cobre.

A química do clique é um método conveniente para conjugar moléculas. Na reação de clique, alcino e azida reagem para formar um triazol por meio da reação catalisada por cobre (I) de Huisgen-Sharpless-Meldal (Fig. 7 C). 129,130 ​​No entanto, a alta concentração de íon Cu 2+ pode substituir o íon Mg 2+ dentro do DNA e o ligante estabilizador de cobre (I) THTA (tris- (1- [3-hidroxipropil] triazolil-4-metil) amina) interfere com o dobramento do origami de DNA. 131 No entanto, foi observada reação de clique em origami de DNA amarrado com mica. 132 A química de clique livre de cobre desenvolvida recentemente resolveu a desvantagem, onde a azida reage com alcinos deformados, como ciclooctilos. Vários tipos de reação livre de Cu foram relatados, 133 por exemplo, um 1,2,4,5-tetrazina (Tz) com um trans-cicloocteno (TCO, Fig. 7 C). 134–136 A principal desvantagem da reação livre de Cu é sua velocidade de reação lenta (10–100 / M / s). Um estudo químico posterior pode superar esse ponto.


Tag RAP: Uma nova abordagem de purificação de proteínas

Crédito: Universidade de Tsukuba

Quer se trate de nossa dieta, construção de força ou como parte dos avanços médicos, não é segredo que as proteínas são uma parte importante de nossas vidas. Rastrear como as proteínas funcionam e se movem nas células e purificar proteínas projetadas são ferramentas importantes para os pesquisadores. As abordagens tradicionais para rotular proteínas de interesse, chamadas de 'marcação', têm a desvantagem de interferir nas características da proteína, incluindo função e localização. Às vezes, essas tags também podem ter reações cruzadas, o que torna as informações que fornecem não específicas. Um sistema de marcação de proteína bem-sucedido precisa ser altamente específico e ter alta afinidade.

Em um estudo publicado em setembro de 2020 em Fronteiras na ciência vegetal, pesquisadores da Universidade de Tsukuba, liderados pelo professor Kenji Miura, descreveram um novo sistema de marcação para detectar e purificar proteínas em células vegetais. Esta abordagem usa uma sequência curta chamada 'tag RAP' para rotular as proteínas. Um anticorpo, PMab-2, é então capaz de reconhecer especificamente a etiqueta RAP e pode ser usado para purificar as proteínas de interesse.

Ao descrever essa abordagem, o professor Miura diz: "A alta afinidade e especificidade da cromatografia de imunoafinidade usando anticorpos monoclonais a torna uma ferramenta muito poderosa, especialmente para a purificação de proteínas expressas em níveis baixos." Um obstáculo para a aplicação dessa abordagem, no entanto, é o alto custo dos reagentes, especialmente o dos anticorpos.

Para contornar isso, o professor Miura e colegas exploraram se poderiam produzir o anticorpo PMab-2 no modelo de planta Nicotiana benthamiana, um parente da planta do tabaco. Eles não apenas conseguiram produzir PMab-2 com sucesso, mas mostraram que o PMab-2 produzido por planta se comportava de maneira semelhante ao produzido em células animais. Essa descoberta abre a porta para a redução do custo de produção de anticorpos e pode ser aplicada de forma mais ampla em campos científicos.

Testando a viabilidade de uma abordagem de purificação por afinidade com RAP-tag / PMab-2, os pesquisadores então expressaram proteínas com RAP-tag em células vegetais. Eles descobriram que essas proteínas marcadas poderiam ser especificamente identificadas usando o anticorpo PMab-2. Além disso, proteínas recombinantes marcadas com RAP, envolvendo a fusão de sequências de mais de uma proteína, e complexos de proteínas também foram expressos nessas células e identificados pelo PMab-2. Estas proteínas também podem ser purificadas a partir de células vegetais usando o anticorpo PMab-2, indicando que a etiqueta RAP pode ser usada tanto para detecção de proteína quanto para purificação de extratos solúveis de plantas.

"As plantas são um recurso extremamente valioso para a biologia molecular", explica o professor Miura. "Eles podem ser usados ​​como biorreatores para produzir grandes quantidades de proteínas porque é improvável que sofram de problemas de contaminação enfrentados por sistemas celulares de bactérias e mamíferos."

Os resultados apresentados pela equipe mostram que essa abordagem tem potencial para ser amplamente aplicada nas ciências moleculares.


Referências

Ito, T. et al. Uma análise abrangente de dois híbridos para explorar o interactoma da proteína de levedura. Proc. Natl Acad. Sci. EUA 98, 4569–4574 (2001).

Krogan, N. J. et al. Panorama global de complexos de proteínas na levedura Saccharomyces cerevisiae. Natureza 440, 637–643 (2006). Um dos dois estudos de AP-MS mais abrangentes em leveduras até o momento (ver REF. 4 ) usando TAP para gerar uma rede de interação de alta confiança e definir complexos de proteínas.

Ho, Y. et al. Identificação sistemática de complexos de proteínas em Saccharomyces cerevisiae por espectrometria de massa. Natureza 415, 180–183 (2002).

Gavin, A.C. et al. A pesquisa do proteoma revela a modularidade da maquinaria da célula de levedura. Natureza 440, 631–636 (2006). Um dos dois estudos de AP-MS mais abrangentes em leveduras (ver REF. 2 ) Ele introduziu a noção do índice de socioafinidade para definir a propensão das proteínas a se associarem em complexos específicos.

Gavin, A.C. et al. Organização funcional do proteoma de levedura por análise sistemática de complexos de proteínas. Natureza 415, 141–147 (2002).

Uetz, P. et al. Uma análise abrangente das interações proteína-proteína em Saccharomyces cerevisiae. Natureza 403, 623–627 (2000).

Formstecher, E. et al. Mapeamento de interação de proteínas: a Drosófila estudo de caso. Genome Res. 15, 376–384 (2005).

Giot, L. et al. Um mapa de interação de proteínas de Drosophila melanogaster. Ciência 302, 1727–1736 (2003).

Stanyon, C. A. et al. UMA Drosófila mapa de interação de proteínas centrado em reguladores do ciclo celular. Genome Biol. 5, R96 (2004).

Li, S. et al. Um mapa da rede interativa do metazoário C. elegans. Ciência 303, 540–543 (2004).

Stelzl, U. et al. Uma rede de interação proteína-proteína humana: um recurso para anotar o proteoma. Célula 122, 957–968 (2005).

Rual, J. F. et al. Rumo a um mapa em escala de proteoma da rede de interação proteína-proteína humana. Natureza 437, 1173–1178 (2005).

Gandhi, T. K. et al. Análise do interactoma da proteína humana e comparação com conjuntos de dados de interação de levedura, minhoca e mosca. Nature Genet. 38, 285–293 (2006).

Fields, S. & amp Sternglanz, R. O sistema de dois híbridos: um ensaio para as interações proteína-proteína. Trends Genet. 10, 286–292 (1994).

von Mering, C. et al. Avaliação comparativa de conjuntos de dados em grande escala de interações proteína-proteína. Natureza 417, 399–403 (2002).

Parrish, J. R., Gulyas, K. D. & amp Finley, R. L. Jr. Yeast two-hybrid contributions to interactome mapping. Curr. Opin. Biotechnol. 17, 387–393 (2006).

Kratchmarova, I., Blagoev, B., Haack-Sorensen, M., Kassem, M. & amp Mann, M. Mechanism of divergent growth factor effects in mesenchymal stem cell differentiation. Ciência 308, 1472–1477 (2005).

Blagoev, B. et al. Uma estratégia proteômica para elucidar as interações proteína-proteína funcionais aplicadas à sinalização de EGF. Nature Biotechnol. 21, 315–318 (2003).

Himeda, C. L. et al. Identificação proteômica quantitativa de six4 como o fator de ligação de trex no intensificador de creatina quinase muscular. Mol. Célula. Biol. 24, 2132–2143 (2004).

Ranish, J. A. et al. Identificação de TFB5, um novo componente da transcrição geral e fator de reparo de DNA IIH. Nature Genet. 36, 707–713 (2004).

Ranish, J. A. et al. O estudo de complexos macromoleculares por proteômica quantitativa. Nature Genet. 33, 349–355 (2003).

Brand, M. et al. Mudanças dinâmicas em complexos de fatores de transcrição durante a diferenciação eritróide reveladas por proteômica quantitativa. Nature Struct. Mol. Biol. 11, 73–80 (2004).

Terpe, K. Visão geral das fusões de proteína tag: dos fundamentos moleculares e bioquímicos aos sistemas comerciais. Appl. Microbiol. Biotechnol. 60, 523–533 (2003).

Domon, B. & amp Aebersold, R. Espectrometria de massa e análise de proteína. Ciência 312, 212–217 (2006).

Nesvizhskii, A. I. Identificação de proteínas por espectrometria de massa em tandem e pesquisa de banco de dados de sequência. Methods Mol. Biol. 367, 87–120 (2006).

Aebersold, R. & amp Mann, M. Mass espectrometria baseada em proteomics. Natureza 422, 198–207 (2003).

Steen, H. & amp Mann, M. The ABC's (e XYZ's) of peptide sequencing. Nature Rev. Mol. Cell Biol. 5, 699–711 (2004).

Domon, B. & amp Aebersold, R. Challenges and opportunity in proteomic data analysis. Mol. Célula. Proteômica 5, 1921–1926 (2006).

Mikesh, L. M. et al. A utilidade da espectrometria de massa ETD na análise proteômica. Biochim. Biophys. Acta 1764, 1811–1822 (2006).

Nesvizhskii, A.I. et al. Avaliação da qualidade do espectro dinâmico e análise computacional iterativa de dados proteômicos shotgun: para uma identificação mais eficiente de modificações pós-tradução, polimorfismos de sequência e novos peptídeos. Mol. Célula. Proteômica 5, 652–670 (2006).

Pedrioli, P. G. et al. Identificação automatizada de locais de SUMOilação usando espectrometria de massa e software de reconhecimento de padrões SUMmOn. Métodos da Natureza 3, 533–539 (2006).

Janssens, V., Goris, J. & amp Van Hoof, C. PP2A: o supressor de tumor esperado. Curr. Opin. Genet. Dev. 15, 34–41 (2005).

Goldberg, Y. Protein phosphatase 2A: quem deve regular o regulador? Biochem. Pharmacol. 57, 321–328 (1999).

Kong, M. et al. A proteína α4 associada a PP2A é um inibidor essencial da apoptose. Ciência 306, 695–698 (2004).

Chen, J., Peterson, R. T. & amp Schreiber, S. L. α4 associa com proteínas fosfatases 2A, 4 e 6. Biochem. Biophys. Res. Comum. 247, 827–832 (1998).

Inui, S. et al. A proteína 1 de ligação ao receptor de Ig (α4) está associada a uma transdução de sinal sensível à rapamicina em linfócitos por meio da ligação direta à subunidade catalítica da proteína fosfatase 2A. Sangue 92, 539–546 (1998).

Gingras, A.C. et al. Um novo complexo de proteína fosfatase evolutivamente conservado envolvido na sensibilidade à cisplatina. Mol. Célula. Proteômica 4, 1725–1740 (2005).

Cosentino, G. P. et al. Eap1p, uma nova proteína eucariótica associada ao fator de iniciação 4E da tradução em Saccharomyces cerevisiae. Mol. Célula. Biol. 20, 4604–4613 (2000).

Collins, S. R. et al. Rumo a um atlas abrangente da interação física de Saccharomyces cerevisiae. Mol. Célula. Proteômica 6, 439–450 (2007).

Abelson, J. N. & amp Simon, M. I. (eds) Guia para purificação de proteínas (Academic Press, 1990).

Weiner, O. D. et al. Os complexos Hem-1 são essenciais para a ativação de Rac, polimerização de actina e regulação da miosina durante a quimiotaxia de neutrófilos. PLoS Biol. 4, e38 (2006).

Panigrahi, A. K. et al. Associação de duas novas proteínas, TbMP52 e TbMP48, com o Trypanosoma brucei Complexo de edição de RNA. Mol. Célula. Biol. 21, 380–389 (2001).

Moyer, S. E., Lewis, P. W. & amp Botchan, M. R. Isolation of the Cdc45 / Mcm2–7 / GINS complex (CMG), a candidate for the eucariótico DNA replication fork helicase. Proc. Natl Acad. Sci. EUA 103, 10236–10241 (2006). Um bom exemplo de fracionamento bioquímico clássico combinado com AP – MS. Os interatores CDC45 foram identificados como componentes dos complexos Mcm2-7 e GINS.

Poot, R. A. et al. HuCHRAC, um complexo de remodelação da cromatina ISWI humana contém hACF1 e duas novas proteínas de dobra de histona. EMBO J. 19, 3377–3387 (2000).

Mueller, C. L. & amp Jaehning, J. A. Ctr9, Rtf1 e Leo1 são componentes do complexo Paf1 / RNA polimerase II. Mol. Célula. Biol. 22, 1971–1980 (2002).

Lindstrom, D. L. et al. Funções duplas para Spt5 no processamento de pré-mRNA e alongamento da transcrição revelado pela identificação de proteínas associadas a Spt5. Mol. Célula. Biol. 23, 1368–1378 (2003).

Ducut Sigala, J. L. et al. A ativação do fator de transcrição NF-κB requer ELKS, uma subunidade reguladora da quinase IκB. Ciência 304, 1963–1967 (2004).

Weber, G. & amp Bocek, P. Desenvolvimentos recentes em focalização isoelétrica de fluxo livre preparativa. Eletroforese 19, 1649–1653 (1998).

Lasserre, J. P. et al. Um estudo complexomic de Escherichia coli usando eletroforese em gel de poliacrilamida SDS / nativo azul bidimensional. Eletroforese 27, 3306–3321 (2006).

Schagger, H. & amp von Jagow, G. Blue electroforese nativa para isolamento de complexos de proteínas de membrana em forma enzimaticamente ativa. Anal Biochem. 199, 223–231 (1991).

Camacho-Carvajal, M. M., Wollscheid, B., Aebersold, R., Steimle, V. & amp Schamel, W. W. Eletroforese em gel de azul nativo / SDS bidimensional de complexos multiproteicos de lisados ​​celulares inteiros: uma abordagem proteômica. Mol. Célula. Proteômica 3, 176–182 (2004). Exemplo do uso de eletroforese nativa azul combinada com MS para o estudo de complexos multiproteicos.

Nijtmans, L. G., Henderson, N. S. & amp Holt, I. J. Blue electroforese nativa para estudar mitocondrial e outros complexos de proteínas. Métodos 26, 327–334 (2002).

Fandino, A. S. et al. Análise LC-nanospray – MS / MS de proteínas hidrofóbicas de complexos de proteínas de membrana isolados por eletroforese nativa azul. J. Mass Spectrom. 40, 1223–1231 (2005).

Andersen, J. S. et al. Caracterização proteômica do centrossoma humano por perfis de correlação de proteínas. Natureza 426, 570–574 (2003). Descrição da estratégia de perfil de correlação de proteínas e seu uso na identificação de novos componentes do centrossoma. Essa abordagem também pode ser aplicada a outras organelas.

Foster, L. J. et al. Um mapa de organelas de mamíferos por perfis de correlação de proteínas. Célula 125, 187–199 (2006).

Marelli, M. et al. A espectrometria de massa quantitativa revela um papel para a GTPase Rho1p na organização da actina na membrana do peroxissoma. J. Cell Biol. 167, 1099–1112 (2004).

Kim, D. H. et al. O mTOR interage com o raptor para formar um complexo sensível a nutrientes que sinaliza para a maquinaria de crescimento celular. Célula 110, 163–175 (2002).

Vasilescu, J., Guo, X. & amp Kast, J. Identificação de interações proteína-proteína usando na Vivo reticulação e espectrometria de massa. Proteômica 4, 3845–3854 (2004). Exemplo do uso de reticulação (com formaldeído) acoplado a AP-MS para identificar interatores de proteína para uma forma ativada de Ras marcado com myc.

Meunier, L., Usherwood, Y. K., Chung, K. T. & amp Hendershot, L. M. Um subconjunto de chaperones e enzimas de dobramento formam complexos multiproteína no retículo endoplasmático para ligar proteínas nascentes. Mol. Biol. Célula 13, 4456–4469 (2002).

Kim, S., Wong, P. & amp Coulombe, P. A. Uma proteína do citoesqueleto de queratina regula a síntese de proteínas e o crescimento das células epiteliais. Natureza 441, 362–365 (2006).

Rashid, K. A., Hevi, S., Chen, Y., Le Caherec, F. & amp Chuck, S. L. Uma abordagem proteômica identifica proteínas em hepatócitos que se ligam à apolipoproteína B. J. Biol. Chem. 277, 22010–22017 (2002).

Schmitt-Ulms, G. et al. Cross-linking de perfusão transcardíaca controlado por tempo para o estudo de interações de proteínas em tecidos complexos. Nature Biotechnol. 22, 724–731 (2004).

Tagwerker, C. et al. Uma etiqueta de afinidade em tandem para purificação em duas etapas sob condições totalmente desnaturantes: aplicação em perfil de ubiquitina e identificação de complexo de proteína combinada com na Vivo reticulação. Mol. Célula. Proteômica 5, 737–748 (2006).

Guerrero, C., Tagwerker, C., Kaiser, P. & amp Huang, L. Uma abordagem proteômica baseada em espectrometria de massa integrada: análise quantitativa de purificado por afinidade em tandem na Vivo complexos de proteínas reticuladas (QTAX) para decifrar a rede de interação com o proteassoma 26S. Mol. Célula. Proteômica 5, 366–378 (2006). Um bom exemplo de uma combinação de abordagens, incluindo proteômica quantitativa, AP e reticulação, para definir as interações proteína-proteína.

Sinz, A. Química cross-linking e espectrometria de massa para mapear estruturas tridimensionais de proteínas e interações proteína-proteína. Mass Spectrom. Rev. 25, 663–682 (2006).

Schmidt, A., Kalkhof, S., Ihling, C., Cooper, DM & amp Sinz, A. Mapeamento de interfaces de proteínas por reticulação química e espectrometria de massa de ressonância de íon ciclotron de transformada de Fourier: aplicação a um complexo de peptídeo calmodulina / adenilil ciclase 8 . EUR. J. Mass Spectrom. 11, 525–534 (2005).

Muller, D. R. et al. Reagentes de reticulação marcados com isótopos. Uma nova ferramenta em análise de interação de proteínas por espectrometria de massa. Anal Chem. 73, 1927–1934 (2001).

Seebacher, J. et al. Análise de cross-linking de proteínas usando espectrometria de massa, cross-linkers codificados por isótopos e processamento de dados computacionais integrados. J. Proteome Res. 5, 2270–2282 (2006).

Tang, X., Munske, G. R., Siems, W. F. & amp Bruce, J. E. Espectrometria de massa identificável estratégia de reticulação para estudar interações proteína-proteína. Anal Chem. 77, 311–318 (2005).

Sobott, F., Hernandez, H., McCammon, M. G., Tito, M. A. & amp Robinson, C. V. Um espectrômetro de massa em tandem para melhor transmissão e análise de grandes conjuntos macromoleculares. Anal Chem. 74, 1402–1407 (2002).

Ilag, L. L. et al. Heptamérico (L12) 6 / L10 em vez de complexos pentaméricos canônicos são encontrados por MS em tandem de ribossomos intactos de bactérias termofílicas. Proc. Natl Acad. Sci. EUA 102, 8192–8197 (2005).

Sharon, M., Taverner, T., Ambroggio, X. I., Deshaies, R. J. & amp Robinson, C. V. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. PLoS Biol. 4, e267 (2006).

Hernandez, H., Dziembowski, A., Taverner, T., Seraphin, B. & amp Robinson, C. V. Arquitetura de subunidade de complexos multiméricos isolados diretamente de células. EMBO Rep. 7, 605–610 (2006). Um bom exemplo do uso de MS de complexo intacto na caracterização da estequiometria de componentes, interações de subunidades e montagem geral de complexos de proteínas. O material purificado por TAP foi usado para elucidar a estrutura do exossomo.

Benesch, J. L. & amp Robinson, C. V. Espectrometria de massa de montagens macromoleculares: preservação e dissociação. Curr. Opin. Struct. Biol. 16, 245–251 (2006).

Gerber, S. A., Rush, J., Stemman, O., Kirschner, M. W. & amp Gygi, S.P. Absolute quantification of protein and phosphoproteins from cell lysates by tandem MS. Proc. Natl Acad. Sci. EUA 100, 6940–6945 (2003).

Beynon, R. J., Doherty, M. K., Pratt, J. M. & amp Gaskell, S. J. Multiplexed absoluto quantification in proteomics using artificial QCAT protein of concatenated signature peptides. Métodos da Natureza 2, 587–589 (2005).

Ross, P. L. et al. Quantificação de proteína multiplexada em Saccharomyces cerevisiae usando reagentes de marcação isobárica reativos com amina. Mol. Célula. Proteômica 3, 1154–1169 (2004).

Hochleitner, E. O. et al. Estequiometria de proteínas de um complexo multiproteico, a pequena ribonucleoproteína nuclear espliceossômica U1 humana: quantificação absoluta usando marcadores codificados por isótopos e espectrometria de massa. J. Biol. Chem. 280, 2536–2542 (2005).

Gingras, A. C., Aebersold, R. & amp Raught, B. Advances in protein complex analysis using mass espectometry. J. Physiol. 563, 11–21 (2005).

Ong, S. E. & amp Mann, M. Mass espectrometria com base em proteômica torna quantitativa. Nature Chem. Biol. 1, 252–262 (2005).

Ong, S. E. et al. Marcação de isótopos estáveis ​​por aminoácidos em cultura de células, SILAC, como uma abordagem simples e precisa para a proteômica de expressão. Mol. Célula. Proteômica 1, 376–386 (2002). Primeira descrição do SILAC, uma abordagem de marcação metabólica que agora é amplamente usada para proteômica quantitativa.

Foster, L. J. et al. Interações insulino-dependentes de proteínas com GLUT4 reveladas por meio de marcação de isótopos estáveis ​​por aminoácidos em cultura de células (SILAC). J. Proteome Res. 5, 64–75 (2006).

Bose, R. et al. Análise fosfoproteômica da sinalização e inibição de Her2 / neu. Proc. Natl Acad. Sci. EUA 103, 9773–9778 (2006).

Gygi, S. P. et al. Análise quantitativa de misturas de proteínas complexas usando marcadores de afinidade codificados por isótopos. Nature Biotechnol. 17, 994–999 (1999). Primeira descrição de ICAT, uma abordagem de marcação química para proteômica quantitativa com isótopos. Posteriormente, foram desenvolvidos diferentes reagentes de marcação que têm como alvo diferentes grupos reativos de proteínas.

Flory, M.R., Griffin, T.J., Martin, D. & amp Aebersold, R. Advances in quantitativo proteomics using stable isotope tags. Trends Biotechnol. 20, S23 – S29 (2002).

Giglia-Mari, G. et al. Uma nova décima subunidade de TFIIH é responsável pela síndrome de reparo de DNA tricotiodistrofia do grupo A. Nature Genet. 36, 714–719 (2004).

Zhang, Y. et al. A espectrometria de massa resolvida no tempo de locais de fosforilação de tirosina na rede de sinalização do receptor do fator de crescimento epidérmico revela módulos dinâmicos. Mol. Célula. Proteômica 4, 1240–1250 (2005).

Corvey, C. et al. Montagem dependente da fonte de carbono do complexo Snf1p quinase em Candida albicans. J. Biol. Chem. 280, 25323–25330 (2005).

Rinner, O. et al. Uma estrutura integrada de espectrometria de massa e computacional para a análise de redes de interação de proteínas. Nature Biotechnol. 25, 345–352 (2007).

Chen, G. I. & amp Gingras, A. -C. Espectrometria de massa de purificação por afinidade (AP-MS) de fosfatases de serina / treonina. Métodos 42, 298–305 (2007).


Diversas tags de afinidade comumente usadas na purificação cromatográfica

As etiquetas de afinidade se tornaram ferramentas poderosas, desde a pesquisa biológica básica até a proteômica estrutural e funcional. Eles foram amplamente utilizados para facilitar a purificação e detecção de proteínas de interesse, bem como a separação de complexos de proteínas. Aqui, discutimos principalmente os benefícios e desvantagens de vários marcadores de afinidade ou epítopo frequentemente usados, incluindo marcador hexahistidina, marcador FLAG, marcador Strep II, marcador de peptídeo de ligação de estreptavidina (SBP), peptídeo de ligação à calmodulina (CBP), glutationa S-transferase (GST), proteína de ligação à maltose (MBP), S-tag, HA tag e c-Myc tag. Em alguns casos, uma etiqueta de afinidade de tamanho grande, como GST ou MBP, pode impactar significativamente na estrutura e atividade biológica da proteína parceira de fusão. Portanto, geralmente é necessário extirpar a tag por protease. As endopeptidases mais comumente usadas são enteroquinase, fator Xa, trombina, vírus do tabaco e protease 3C do rinovírus humano. As características de proteólise dessas proteases são descritas a fim de fornecer uma orientação geral sobre a remoção proteolítica dos marcadores de afinidade.

1. Introdução

A expressão e purificação de proteínas recombinantes têm se tornado cada vez mais comuns para a caracterização da estrutura e função das proteínas nos últimos anos. É necessário purificar a proteína de interesse para obter concentração suficiente com alta pureza antes que sua função, estrutura e interações com outras proteínas possam ser estudadas. Vários métodos têm sido usados ​​para enriquecer proteínas de interesse de extratos biológicos brutos. O método mais eficaz é a purificação por afinidade, em que a proteína de interesse é enriquecida em virtude de suas propriedades de ligação específicas a uma função de ligante imobilizado de maneira semelhante à das interações anticorpo-antígeno. Tags de afinidade ou epítopo são sequências de peptídeos, que são ferramentas extremamente poderosas e frequentemente anexadas à proteína alvo de interesse. Inicialmente, as tags de afinidade foram desenvolvidas para purificar proteínas recombinantes, mas agora também são usadas em western blot, imunohistoquímica (IHC), imunoprecipitação (IP), citometria de fluxo (FCM), localização de proteínas e assim por diante. No entanto, cada tag tem suas próprias vantagens e desvantagens distintas [1, 2], que são importantes a serem consideradas antes da seleção final da tag a ser usada. Isso depende da aplicação e do requisito de especificidade, solubilidade, ligação e condições de eluição.

Geralmente, os marcadores usados ​​para melhorar a produção de proteínas recombinantes podem ser divididos em marcadores de purificação e solubilidade [3]. As etiquetas de afinidade incluem enzimas, domínios de proteína ou pequenos polipeptídeos e a maioria dos quais se ligam com alta especificidade a uma variedade de substratos, como carboidratos, pequenas biomoléculas, quelatos metálicos, anticorpos e assim por diante, para permitir a purificação rápida e eficiente das proteínas. Enquanto os marcadores de solubilidade aumentam o dobramento e a solubilidade adequados de uma proteína, eles são frequentemente usados ​​em conjunto com um marcador de afinidade para auxiliar na purificação. Neste contexto, resumimos as características e aplicações de vários marcadores de afinidade comuns que estão disponíveis para sistemas de expressão de proteínas procarióticas e eucarióticas (Tabela 1).

2. Tags de afinidade e seus recursos

Expressão da proteína recombinante em Escherichia coli (E. coli) ou células de mamífero como uma proteína de fusão com etiqueta de afinidade vizinha é um dos métodos mais populares para purificação de proteína ou complexo de proteína. Os marcadores de afinidade são polipeptídeos artificiais que foram geralmente enxertados no terminal N ou C de uma proteína alvo através da inserção da sequência de cDNA que codificou o peptídeo marcador em uma estrutura de leitura aberta correspondente da proteína alvo (Figura 1). Além de facilitar a purificação de proteínas recombinantes, as tags de afinidade também podem aumentar o rendimento, a solubilidade e até mesmo o dobramento dos parceiros alvo [2, 4]. As marcas de tamanho pequeno (por exemplo, 6 × His, FLAG, Strep II e CBP) têm os benefícios de minimizar o efeito na estrutura, atividade e características da proteína recombinante e, portanto, geralmente não há necessidade de remover. As marcas de tamanho grande, incluindo MBP e GST, têm influências positivas na solubilidade da proteína e na eficiência de expressão, mas a imunogenicidade e o maior consumo de energia metabólica celular em células superexpressas são as principais desvantagens em comparação com as marcas de tamanho pequeno.


(uma)
(b)
(uma)
(b) (a) Ilustração esquemática da proteína de fusão marcada com N-terminal. O espaçador representa uma sequência de clivagem de endopeptidase e / ou solubilidade e intensificadores de dobramento. (b) Princípio de purificação por afinidade de proteína de fusão e remoção da etiqueta (apenas para marcação N-terminal). As proteínas de interação serão copurificadas com a proteína de fusão marcada em condições nativas.

O tag hexahistidine (6 × His-tag) é o tag de afinidade mais frequentemente usado para enriquecimento de proteínas. As proteínas marcadas com His podem ser purificadas facilmente pelos íons metálicos quelados como ligantes de afinidade. A base para a purificação por afinidade é conhecida como cromatografia de afinidade de metal imobilizado (IMAC) [5]. His-tag pode se ligar melhor à resina IMAC em condições de tampão quase neutras (pH fisiológico e força iônica) e, portanto, as proteínas de fusão podem ser eluídas com tampão de ligação contendo certas concentrações de imidazol. Se possível, a eluição também é realizada com baixo pH (por exemplo, 0,1 M de glicina-HCl, pH 2,5) ou um excesso de quelante forte (por exemplo, EDTA). O 6 × His-tag tem vários méritos, incluindo tamanho menor, ausência de carga elétrica, baixos níveis de toxicidade e imunogenicidade [3]. A marcação His fornece bons rendimentos de proteína de fusão a partir de resinas baratas de alta capacidade com pureza moderada de E. coli extratos, mas a purificação relativamente pobre de extratos de células de mamíferos [5]. Por exemplo, expressamos uma proteína recombinante FAM92A1-289 fundida com 6 × His-tag em E. coli e purificou-o usando resina de afinidade carregada com Ni 2+ para estudos de função adicionais [6]. No sistema de expressão procariótica, a maioria da proteína marcada com His recombinante existe na forma de corpo de inclusão e, finalmente, cerca de 4 mg de proteína FAM92A1-289 foi obtida com alta pureza a partir de 1 L de E. coli cultura [6].

A proteína de ligação à maltose (MBP) foi um dos marcadores de afinidade a ser utilizado com o objetivo de superar problemas associados à expressão e purificação de proteínas de fusão [7]. Geralmente, as proteínas recombinantes marcadas com MBP podem aliviar a toxicidade e melhorar o nível de expressão e a solubilidade da proteína [8-10]. A marcação MBP pode produzir uma porcentagem maior de proteína recombinante do que a marcação de poli-histidina [11, 12]. No entanto, a desvantagem da MBP é o tamanho e a imunogenicidade da etiqueta de afinidade, o que complica qualquer aplicação a jusante. A purificação de proteínas marcadas com MBP é conseguida por cromatografia convencional baseada em resina de amilose. A eluição das proteínas fundidas com MBP ocorre em pH neutro usando condições tampão contendo maltose moderadas [13]. A etiqueta MBP é eficaz quando colocada na extremidade N-terminal ou C-terminal das proteínas alvo. No entanto, como o grande tamanho desta marca MBP coloca uma carga metabólica pesada na célula hospedeira, a proteína alvo permanece insolúvel ou está sujeita à agregação quando a marca MBP é removida [14]. Além disso, recentemente uma nova etiqueta de fusão SUMO parece aumentar a expressão e solubilidade da proteína em procariotos e eucariotos [14, 15].

-transferase (GST) tag é outra tag de afinidade bem estabelecida com base na forte afinidade de GST para a glutationa imobilizada [16]. A tag GST é mais adequada para uso na expressão procariótica porque GSTs são uma família de proteínas citosólicas multifuncionais que estão presentes em organismos eucarióticos, mas geralmente não são encontradas em bactérias [17]. Semelhante ao marcador MBP, o marcador GST tem sido usado há muito tempo para aumentar a solubilidade das proteínas de fusão em E. coli [18]. As proteínas marcadas com GST são capturadas pela glutationa imobilizada e, em seguida, são eluídas em condições suaves e não desnaturantes usando glutationa reduzida [19].

O Strep-tag é um octapeptídeo que se liga à estreptavidina [20, 21]. A estreptavidina também foi otimizada para aumentar a capacidade de ligação a peptídeos, o que resultou no desenvolvimento de Strep-Tactin. O derivado da estreptavidina, a saber, Strep-Tactin, leva a uma afinidade mais alta para a tag Strep II [22-24]. Strep II tag não interfere com o dobramento ou bioatividade e também não induz a agregação de proteínas.Proteínas de fusão Strep podem ser capturadas pelo ligante Strep-Tactin imobilizado na matriz de base e purificado em uma etapa a partir de extratos celulares brutos sob condições fisiológicas e, portanto, a etiqueta é especialmente aplicada à geração de proteínas funcionais ou complexos de proteínas [25]. Ao mesmo tempo, a tag Strep II pode fornecer um compromisso aceitável de purificação excelente com rendimentos puros a um custo moderado [6]. Além disso, o tag do peptídeo de ligação à estreptavidina de 38 aminoácidos (SBP) foi desenvolvido, o qual se liga à estreptavidina mais fortemente do que o Step-tag II e o tag nativo [26]. As proteínas Strep-tag ou SBP-fundidas podem ser dissociadas do ligante covalentemente ligado à resina de agarose por tampão de eluição com biotina ou destiobiotina [27, 28].

O tag de peptídeo de ligação a calmodulina (CBP) foi inventado para purificação de proteína recombinante de bactérias com base em alta afinidade para calmodulina com afinidade nanomolar em condições fisiológicas na presença de cálcio [29]. A tag CBP é derivada do fragmento C-terminal da quinase de cadeia leve da miosina muscular humana e, portanto, não é recomendada para purificação de proteínas de fusão em células eucarióticas porque as proteínas endógenas podem interferir com a calmodulina de uma maneira dependente de cálcio [30]. Semelhante à hexahistidina e às tags Strep II, a tag CBP tem um impacto desprezível na atividade biológica ou nas características físicas do parceiro-alvo. Proteínas fundidas com CBP são eluídas com uma tira de cálcio do ambiente sob condições tampão muito moderadas (por exemplo, EGTA 2 mM, pH 8,0) [31].

O domínio de ligação à quitina (CBD) de Bacillus circulans consiste em 51 aminoácidos, que é comumente usado como marcadores para purificação por afinidade de proteínas recombinantes em combinação com inteínas de auto-processamento em sistemas bacterianos [32]. Após a seleção por afinidade da proteína de fusão em uma matriz de quitina, a inteína sofre clivagem específica por um reagente tiol ou mudança de pH e temperatura que libera a proteína alvo da etiqueta ligada à quitina [3].

O tag FLAG é um epítopo de tag de octapeptídeo hidrofílico que foi introduzido para purificar proteínas de fusão [33]. É provável que esteja localizado na superfície de uma proteína de fusão devido à sua natureza hidrofílica e, portanto, é mais provável que seja acessível a anticorpos. O tag FLAG liga-se a vários anticorpos monoclonais anti-FLAG específicos, como M1, M2 e M5, com reconhecimento e características de ligação diferentes [34, 35]. As proteínas de fusão FLAG podem ser reconhecidas por anticorpo monoclonal com dependente de cálcio (por exemplo, M2) ou de maneira independente de cálcio [32]. Em particular, a etiqueta anexada ao terminal N da proteína de fusão é necessária para a purificação por imunoafinidade com anticorpo monoclonal M1, enquanto M2 é insensível à posição. A eluição das proteínas marcadas com FLAG é realizada com o peptídeo FLAG (por exemplo, 3 × FLAG peptídeo) ou tampão de glicina de baixo pH (por exemplo, glicina 0,1 M, pH 3,5) [36].

O sistema S-tag é baseado na ligação específica entre os 15 aminoácidos S-tag e a proteína S, ambos derivados da ribonuclease A pancreática (RNase A). Qualquer proteína fundida com o S-tag pode ser convenientemente purificada, detectada e até mesmo quantificada [37-39]. No entanto, a eluição de proteínas marcadas com S é realizada sob condições altamente rigorosas na presença de NaSCN 3 M, MgCl 3 M2ou citrato 0,2 M (pH 2).

Além dos marcadores de afinidade descritos acima, outros polipeptídeos, como o marcador HA e o marcador c-Myc são bem caracterizados e marcadores altamente imunorreativos que são geralmente usados ​​para a separação de proteínas marcadas de sobrenadantes de cultura de células e lisado de células em condições de pH neutro e, assim, são ferramentas úteis para coimunoprecipitação (co-IP), mas também são facilmente detectadas por western blot. Além disso, eles são pequenos e, portanto, improváveis ​​de interferir com a bioatividade e função das proteínas parceiras de fusão. A tag HA vem da hemaglutinina da influenza humana (HA) correspondente aos aminoácidos 98-106 e é um epítopo imunorreativo forte que o torna popular para isolar, purificar, detectar e rastrear a proteína de interesse [40, 41]. As proteínas marcadas com HA recombinante podem ser separadas por anticorpo monoclonal anti-HA altamente específico que é imobilizado covalentemente na resina. As proteínas marcadas com HA podem ser eluídas por abordagem de eluição suave com epítopo HA a 1 mg / mL em TBS. Por outro lado, três opções de eluição química estão disponíveis: glicina 0,1 M (pH 2–2,8), NaSCN 3 M ou NaOH 50 mM.

A tag c-Myc se origina do c-myc produto do gene. A proteína recombinante marcada com c-Myc tag pode ser reconhecida por um conhecido anticorpo 9E10 de alta afinidade [42]. Embora possa ser adicionado ao terminal C ou terminal N de uma proteína, não é recomendado anexar a marca c-Myc diretamente atrás do peptídeo sinal de uma proteína secretora porque a marca pode interferir com a translocação para a via secretora. Em qualquer caso, a tag c-Myc pode ser usada em muitos ensaios diferentes, como estudos de localização subcelular por imunofluorescência ou detecção por western blot. Em condições nativas, a eluição de proteínas marcadas com c-Myc pode ser alcançada pela adição do peptídeo com marcação c-Myc (0,5 mg / mL em PBS) que compete com as proteínas recombinantes.

3. Estratégia de marcação combinatória e os estudos de parceiros de interação de proteínas

Os complexos de proteínas e as interações proteína-proteína constituem as bases funcionais das atividades vitais dentro da célula. Muitas combinações de tags foram desenvolvidas desde que a técnica de purificação por afinidade em tandem (TAP) apareceu no final da década de 1990 [43]. A marcação TAP, que emprega duas etapas de purificação de afinidade sequenciais, pode reduzir significativamente a chance de contaminantes retidos no eluato. Tag de dupla afinidade é uma abordagem eficiente para os complexos de proteína de purificação em condições nativas [44, 45]. Como uma ferramenta poderosa para separar o complexo de proteínas em interação, a estratégia de marcação TAP é amplamente utilizada nos estudos de redes de interação de proteínas. A combinação da técnica TAP com espectrometria de massa (MS) tem sido amplamente adotada como um método altamente eficiente para identificar e caracterizar os componentes dos complexos de proteínas [46-49]. Por exemplo, desenvolvemos um sistema de etiqueta TAP contendo um FLAG e uma etiqueta CBP para purificar os parceiros de ligação com uma proteína isca 14-3-3

em células de mamíferos, e uma nova proteína de interação HSP70 foi identificada por duas etapas de purificação por afinidade [48].

Várias combinações de marcas diferentes foram relatadas até agora, como His e FLAG, His e Strep II, FLAG e Strep II e assim por diante [50, 51]. Felizmente, muitos vetores de expressão TAP estão disponíveis comercialmente hoje. Ao todo, a adoção de tag na estratégia TAP precisa determinar cuidadosamente de acordo com as vantagens e desvantagens de várias tags e as características de uma proteína alvo. Para escolher uma combinação eficaz, normalmente é necessário considerar as habilidades das etiquetas para melhorar o rendimento, aumentar a solubilidade e facilitar a purificação de seus parceiros de fusão. Além disso, se as etiquetas de afinidade têm o potencial de interferir com estudos estruturais ou funcionais, a etiqueta fundida deve ser removida da proteína isca como segue.

4. Remoção de tags de afinidade

O uso de tag de afinidade para a purificação de proteínas em sistemas de expressão procarióticos e eucarióticos é um método bem aceito. Em teoria, não se pode excluir que os marcadores de afinidade, especialmente aqueles com tamanho grande, podem ter o potencial de interferir na estrutura e função das proteínas. Se essa circunstância acontecer, medidas devem ser tomadas para removê-los. Qualquer marca de afinidade, seja pequena ou grande, pode ser facilmente removida pela introdução de uma sequência de reconhecimento de protease específica entre a marca e a proteína alvo (Figura 1 (b)). As endopeptidases mais frequentemente utilizadas são enterocinase, fator Xa, trombina, vírus da gravação do tabaco (TEV) e protease 3C do rinovírus humano. As vantagens e desvantagens dessas endopeptidases foram amplamente discutidas em trabalhos anteriores da literatura [1, 52-54]. Além disso, outras endopeptidases (por exemplo, PreScission e Sortase A) e exopeptidases (por exemplo, DAPase, Aeromonas aminopeptidase, aminopeptidase M e carboxipeptidase A e B) foram descritas exaustivamente para a remoção de marcadores de afinidade de proteínas recombinantes [1, 52].

As etiquetas de tamanho pequeno, como 6 × His, FLAG, Strep II e CBP geralmente não precisam ser removidas para aplicações posteriores após a purificação. Enterokinase possui atividade semelhante à tripsina e cliva especificamente após o resíduo de lisina em uma sequência de reconhecimento canônico (DDDDK) [55]. A enterocinase pode, às vezes, clivar em outros resíduos básicos, dependendo da conformação do substrato da proteína [56-60]. Além disso, a eficiência de clivagem da enterocinase está intimamente associada ao resíduo de aminoácido após a jusante do local de reconhecimento [61, 62]. Não se clivará no local de reconhecimento se a sequência de reconhecimento for seguida por prolina. No entanto, a adição de ureia (1–4 M) pode melhorar muito a especificidade da clivagem da enterocinase e reduzir a clivagem adventícia [63]. Em particular, a tag FLAG (DYKDDDDK) contém o local de clivagem da enterocinase (sublinhado) que permite a remoção da etiqueta de afinidade após a purificação.

Como a enteroquinase, tanto a trombina quanto o fator Xa são proteases de serina semelhantes à tripsina que irão clivar as ligações peptídicas no lado carboxila de um resíduo de aminoácido básico. O fator Xa cliva após o resíduo de arginina em seu local de clivagem preferido (I-E / D-G-R) e ocasionalmente cliva em outros locais [64-66]. Semelhante à enterocinase, o fator Xa não cliva em um local seguido por prolina ou arginina. Para a sequência de reconhecimento mais comum (LVPRG) ou (LVPRGS), a trombina irá clivar seletivamente após o resíduo de arginina [54]. Assim, ao contrário da enterocinase e do fator Xa, a clivagem da trombina pode resultar na retenção de um ou dois resíduos de aminoácidos do terminal amino na proteína de interesse.

A protease TEV é uma cisteína endoprotease altamente específica do local. Sua sequência de reconhecimento ideal é E-N-L-Y-F-Q-G / S e a clivagem ocorre entre os resíduos de glutamina e glicina / serina [67].

Sortase A é uma tiol transpeptidase procariótica que pode hidrolisar as proteínas de fusão ao reconhecer uma sequência de sinal de classificação do terminal carboxila (LPETG) e clivar a ligação peptídica treonina-glicina [68, 69]. A atividade de clivagem da enzima pode ser estimulada por íons de cálcio [70], e uma etapa de afinidade adicional é necessária para a remoção da etiqueta da coluna, como o uso de sortase A imobilizada [71].

A protease de pré-sucessão é uma protease 3C tipo 14 de rinovírus humano (HRV) marcada com GST e reconhece especificamente a sequência de aminoácidos LEVLFQGP ou seu subconjunto de sequências que incluem a sequência de aminoácidos central (sublinhada), clivando entre os resíduos de glutamina e glicina [72, 73]. A enzima recombinante é projetada especificamente para facilitar a remoção da protease, permitindo a imobilização da protease simultânea e a clivagem do marcador de afinidade GST.

Além dos métodos de clivagem de etiqueta descritos acima, a remoção da etiqueta sem o uso de uma protease também é viável pela introdução de um elemento de proteína com capacidade de autossplicing em uma variedade de sistemas de purificação baseados em etiqueta. Esses elementos são proteínas naturalmente autossplicantes chamadas inteínas, que podem se extirpar da proteína-mãe [74, 75]. Inteínas podem ser projetadas em junções de junção N- ou C-terminal para obter inteínas autocliváveis, que podem então ser usadas para alcançar a autoclivagem de vários marcadores de afinidade. As aplicações específicas foram exaustivamente revisadas por outros autores [76-78].

5. Conclusões

A purificação por afinidade é uma abordagem de isolamento de biomoleculares de extratos celulares com base em uma interação altamente específica como aquela entre antígenos e anticorpos, bem como receptores e ligantes. A etiqueta de afinidade é absolutamente necessária para muitas aplicações em ciências da vida, incluindo a purificação da proteína de interesse. Embora cada etiqueta tenha suas vantagens e desvantagens específicas na eficiência de purificação, os sistemas de purificação de afinidade versáteis com diferentes etiquetas de afinidade são poderosos para isolar proteínas recombinantes e complexos de proteínas. Para resumir, não existe um sistema de purificação de afinidade universal para explorar diferentes proteínas de isca e seus parceiros de ligação no momento. Até agora, é possível gerar várias proteínas humanas purificadas ou domínios de proteínas para proteômica de afinidade e estudos de genômica estrutural em grande escala até agora [79].

Agradecimentos

Este trabalho foi financiado pelo Programa Nacional de Pesquisa Básica da China (2011CB910703, 2013CB911303), a National 863 High Tech Foundation (SS2014AA020608) e a Natural Science Foundation of China (30800581, 31071235). Esta pesquisa também foi financiada pelo New Century Excellent Talents in University (NCET-10-0595) e pelo Fundo de Pesquisa Especializada para o Programa de Doutorado em Ensino Superior (20120181110025).

Referências

  1. J. Arnau, C. Lauritzen, G. E. Petersen, e J. Pedersen, "estratégias atuais para o uso de marcadores de afinidade e remoção de marcadores para a purificação de proteínas recombinantes", Expressão e purificação de proteínas, vol. 48, nº 1, pp. 1–13, 2006. Ver em: Publisher Site | Google Scholar
  2. D. S. Waugh, “Aproveitando ao máximo as tags de afinidade”, Tendências em Biotecnologia, vol. 23, não. 6, pp. 316–320, 2005. Ver em: Publisher Site | Google Scholar
  3. D. Walls e S. T. Loughran, "Marcando proteínas recombinantes para aumentar a solubilidade e auxiliar na purificação", Métodos em Biologia Molecular, vol. 681, pp. 151–175, 2011. Ver em: Google Scholar
  4. D. R. Smyth, M. K. Mrozkiewicz, W. J. McGrath, P. Listwan e B. Kobe, "Crystal structure of fusion protein with large-affinity tags", Ciência de Proteínas, vol. 12, não. 7, pp. 1313–1322, 2003. Ver em: Publisher Site | Google Scholar
  5. J. J. Lichty, J. L. Malecki, H. D. Agnew, D. J. Michelson-Horowitz e S. Tan, "Comparison of affinity tags for protein purification", Expressão e purificação de proteínas, vol. 41, no. 1, pp. 98–105, 2005. Ver em: Publisher Site | Google Scholar
  6. S. Liang, F. Gong, X. Zhao et al., "Expressão procariótica, purificação de uma nova proteína relativa a tumor FAM92A1-289 e sua caracterização em carcinoma de células renais", Cartas de Câncer, vol. 276, no. 1, pp. 81–87, 2009. Veja em: Publisher Site | Google Scholar
  7. C. di Guan, P. Li, P. D. Riggs, e H. Inouye, “Vetores que facilitam a expressão e purificação de peptídeos estranhos em Escherichia coli por fusão com a proteína de ligação à maltose ”, Gene, vol. 67, nº 1, pp. 21-30, 1988. Ver em: Google Scholar
  8. S. N. Hewitt, R. Choi, A. Kelley, G. J. Crowther, A. J. Napuli, e W. C. Van Voorhis, “Expression of protein in Escherichia coli como fusões com proteína de ligação à maltose para resgatar alvos não expressos em uma expressão de proteína de alto rendimento e pipeline de purificação ”, Acta Crystallographica F, vol. 67, nº 9, pp. 1006–1009, 2011. Veja em: Publisher Site | Google Scholar
  9. J. D. Fox, K. M. Routzahn, M. H. Bucher, e D. S. Waugh, "proteínas de ligação a maltodextrina de diversas bactérias e archaea são potentes intensificadores de solubilidade", FEBS Letters, vol. 537, no. 1 & # x20133, pp. 53–57, 2003. Veja em: Publisher Site | Google Scholar
  10. D. Sachdev e J. M. Chirgwin, "Fusions to maltose-binding protein: control of dobramento e solubilidade na purificação de proteínas", Métodos em Enzimologia, vol. 326, pp. 312-321, 2000. Ver em: Google Scholar
  11. M. Lebendiker e T. Danieli, "Purification of protein fused to maltose-binding protein", Métodos em Biologia Molecular, vol. 681, pp. 281–293, 2011. Ver em: Google Scholar
  12. J. P. Bannantine, J. K. Hansen, M. L. Paustian et al., “Expression and immunogenicity of proteínas codificadas por sequências específicas para Mycobacterium avium subsp. paratuberculose,” Journal of Clinical Microbiology, vol. 42, não. 1, pp. 106-114, 2004. Ver em: Publisher Site | Google Scholar
  13. F. Guo e G. Zhu, "Presença e remoção de uma atividade de oxidação de NADH contaminante em proteínas de fusão de proteína de ligação de maltose recombinante expressas em Escherichia coli,” BioTécnicas, vol. 52, no. 4, pp. 247–253, 2012. Ver em: Publisher Site | Google Scholar
  14. A. Malhotra, "Marcação para expressão de proteínas", Métodos em Enzimologia, vol. 463, pp. 239–258, 2009. Veja em: Publisher Site | Google Scholar
  15. R. J. Peroutka III, S. J. Orcutt, J. E. Strickler e T. R. Butt, "tecnologia de fusão SUMO para expressão e purificação de proteínas melhoradas em procariotas e eucariotas", em Expressão gênica heteróloga em E. coli, T. C. Evans e M. Q. Xu, Eds., Vol. 705 de Métodos em Biologia Molecular, pp. 15–30, 2011. Ver em: Google Scholar
  16. D. B. Smith e K. S. Johnson, "Purificação em uma única etapa de polipeptídeos expressos em Escherichia coli como fusões com glutationa S-transferase, ” Gene, vol. 67, nº 1, pp. 31–40, 1988. Ver em: Google Scholar
  17. M. Hammarstr & # xf6m, N. Hellgren, S. van den Berg, H. Berglund e T. H & # xe4rd, “Rastreio rápido para melhor solubilidade de pequenas proteínas humanas produzidas como proteínas de fusão em Escherichia coli,” Ciência de Proteínas, vol. 11, não. 2, pp. 313–321, 2002. Ver em: Publisher Site | Google Scholar
  18. C. Wang, AF Castro, DM Wilkes e GA Altenberg, “Expressão e purificação do primeiro domínio de ligação de nucleotídeo e região de ligação do produto do gene de resistência a múltiplas drogas humana: comparação de fusões a glutationa S-transferase, tioredoxina e proteína de ligação à maltose , ” Biochemical Journal, vol. 338, não. 1, pp. 77–81, 1999. Ver em: Publisher Site | Google Scholar
  19. S. Harper e D. W.Speicher, “Purificação de proteínas fundidas a glutationa S-transferase,” Métodos em Biologia Molecular, vol. 681, pp. 259–280, 2011. Ver em: Google Scholar
  20. T. G. M. Schmidt, J. Koepke, R. Frank e A. Skerra, "interação molecular entre o peptídeo de afinidade strep-lag e seu alvo cognato, estreptavidina," Journal of Molecular Biology, vol. 255, não. 5, pp. 753–766, 1996. Ver em: Publisher Site | Google Scholar
  21. T. G. M. Schmidt e A. Skerra, "The random peptide library-assisted engineering of a C-terminal affinity peptide, útil para a detecção e purificação de um fragmento funcional Ig Fv," Engenharia de Proteínas, vol. 6, não. 1, pp. 109-122, 1993. Ver em: Google Scholar
  22. T. G. M. Schmidt e A. Skerra, "The Strep-tag system for one-step purification and high-affinity detecção or capture of protein", Nature Protocols, vol. 2, não. 6, pp. 1528–1535, 2007. Ver em: Publisher Site | Google Scholar
  23. I. P. Kornd & # xf6rfer e A. Skerra, "A afinidade aprimorada de estreptavidina projetada para o peptídeo Strep-tag II é devido a uma conformação aberta fixa da alça semelhante a uma tampa no local de ligação", Ciência de Proteínas, vol. 11, não. 4, pp. 883–893, 2002. Veja em: Publisher Site | Google Scholar
  24. S. Voss e A. Skerra, "Mutagênese de uma alça flexível em estreptavidina leva a maior afinidade para o peptídeo Strep-tag II e melhor desempenho na purificação de proteína recombinante", Engenharia de Proteínas, vol. 10, não. 8, pp. 975–982, 1997. Ver em: Google Scholar
  25. M. R. Junttila, S. Saarinen, T. Schmidt, J. Kast e J. Westermarck, "Single-step Strep-tag purification for the Isolation and Identification of Protein Complexes from Mammalian cells", Proteômica, vol. 5, não. 5, pp. 1199–1203, 2005. Ver em: Publisher Site | Google Scholar
  26. I. H. Barrette-Ng, S. C. Wu, W. M. Tjia, S. L. Wong, e K. K. Ng, "A estrutura do complexo SBP-Tag-estreptavidina revela um novo andaime helicoidal que faz ponte sobre bolsões de ligação em subunidades separadas," Acta Crystallographica D, vol. 69, nº parte 5, pp. 879–887, 2013. Ver em: Publisher Site | Google Scholar
  27. A. D. Keefe, D. S. Wilson, B. Seelig e J. W. Szostak, "One-step purification of recombinant proteínas using a nanomolar-affinity streptavidin-binding peptide, the SBP-tag," Expressão e purificação de proteínas, vol. 23, não. 3, pp. 440–446, 2001. Ver em: Publisher Site | Google Scholar
  28. T. G. Schmidt, L. Batz, L. Bonet et al., "Desenvolvimento do Twin-Strep-tag (R) e sua aplicação para purificação de proteínas recombinantes de sobrenadantes de cultura de células", Expressão e purificação de proteínas, vol. 92, no. 1, pp. 54–61, 2013. Ver em: Publisher Site | Google Scholar
  29. R. E. Stofko-Hahn, D. W. Carr e J. D. Scott, “A single step purification for recombinant protein. Caracterização de um fragmento de proteína associada a microtúbulos (MAP 2) que se associa com a proteína quinase dependente de cAMP tipo II, ” FEBS Letters, vol. 302, nº 3, pp. 274-278, 1992. Ver em: Publisher Site | Google Scholar
  30. J. F. Head, "A better grip on calmodulin", Biologia Atual, vol. 2, não. 11, pp. 609–611, 1992. Ver em: Google Scholar
  31. S. Honey, B. L. Schneider, D. M. Schieltz, J. R. Yates e B. Futcher, "A novel multiple affinity purification tag and its use in identification of protein associated with a cyclin-CDK complex", Pesquisa de ácidos nucléicos, vol. 29, nº 4, artigo E24, 2001. Ver em: Google Scholar
  32. K. Terpe, "Visão geral das fusões de proteínas de tag: dos fundamentos moleculares e bioquímicos aos sistemas comerciais", Microbiologia e Biotecnologia Aplicada, vol. 60, não. 5, pp. 523–533, 2003. Ver em: Google Scholar
  33. T. P. Hopp, K. S. Prickett, V. L. Price et al., "Uma curta sequência de marcador polipeptídico útil para identificação e purificação de proteína recombinante", Biotecnologia, vol. 6, não. 10, pp. 1204–1210, 1988. Ver em: Google Scholar
  34. A. Einhauer e A. Jungbauer, "O peptídeo FLAG, uma etiqueta de fusão versátil para a purificação de proteínas recombinantes", Journal of Biochemical and Biophysical Methods, vol. 49, no. 1 & # x20133, pp. 455–465, 2001. Veja em: Publisher Site | Google Scholar
  35. T. P. Hopp, B. Gallis e K. S. Prickett, "Propriedades de ligação de metal de um anticorpo monoclonal dependente de cálcio", Imunologia Molecular, vol. 33, não. 7-8, pp. 601–608, 1996. Ver em: Publisher Site | Google Scholar
  36. M. Futatsumori-Sugai, R. Abe, M. Watanabe et al., "Utilization of Arg-elution method for FLAG-tag based chromatography", Expressão e purificação de proteínas, vol. 67, nº 2, pp. 148–155, 2009. Veja em: Publisher Site | Google Scholar
  37. T. Asai, L. A. Wims e S. L. Morrison, "Uma interação entre a etiqueta S & # x2022 e a proteína S & # x2022 derivada da ribonuclease 1 humana permite a conjugação específica do local de uma enzima a um anticorpo para a entrega de droga direcionada", Journal of Immunological Methods, vol. 299, no. 1-2, pp. 63–76, 2005. Ver em: Publisher Site | Google Scholar
  38. M. V. Backer, T. I. Gaynutdinov, R. Aloise, K. Przekop e J. M. Backer, "Engineering S-protein fragments of bovine ribonuclease A for target drug delivery", Expressão e purificação de proteínas, vol. 26, no. 3, pp. 455–461, 2002. Ver em: Publisher Site | Google Scholar
  39. J. S. Hackbarth, S. H. Lee, X. W. Meng, B. T. Vroman, S. H. Kaufmann e L. M. Karnitz, "S-peptide epitope tagging for protein purification, expression monitoring, and localization in mamífero cells", BioTécnicas, vol. 37, no. 5, pp. 835–839, 2004. Ver em: Google Scholar
  40. J. M. Moon, G. Y. Kim e H. Rhim, "Uma nova ideia para o monitoramento simples e rápido da expressão gênica: exigência de sequências de nucleotídeos que codificam uma etiqueta HA N-terminal na expressão dirigida pelo promotor T7 em E. coli,” Cartas de Biotecnologia, vol. 34, nº 10, pp. 1841–1846, 2012. Ver em: Publisher Site | Google Scholar
  41. L. Schembri, R. Dalibart, F. Tomasello, P. Legembre, F. Ichas e F. De Giorgi, "The HA tag is cleaved and pere immunoreactivity during apoptose", Métodos da Natureza, vol. 4, não. 2, pp. 107–108, 2007. Ver em: Publisher Site | Google Scholar
  42. M. C. Hillman, L. S. Yang, S. Sun et al., "Um sistema abrangente para purificação de proteínas e análise bioquímica com base em anticorpos para o peptídeo c-myc", Expressão e purificação de proteínas, vol. 23, não. 2, pp. 359–368, 2001. Ver em: Publisher Site | Google Scholar
  43. G. Rigaut, A. Shevchenko, B. Rutz, M. Wilm, M. Mann e B. Seraphin, "Um método de purificação de proteína genérica para caracterização de complexo de proteína e exploração de proteoma", Nature Biotechnology, vol. 17, não. 10, pp. 1030–1032, 1999. Veja em: Publisher Site | Google Scholar
  44. O. Puig, F. Caspary, G. Rigaut et al., “The tandem affinity purification (TAP) method: a general procedure of protein complex purification,” Métodos, vol. 24, não. 3, pp. 218–229, 2001. Ver em: Publisher Site | Google Scholar
  45. D. Bailey, L. Urena, L. Thorne e I. Goodfellow, "Identificação de parceiros de interação de proteínas usando purificação de afinidade em tandem", Journal of Visualized Experiments, não. 60, ID do artigo e3643, 2012. Exibir em: Site do editor | Google Scholar
  46. S. Liang, Z. Xu, X. Xu, X. Zhao, C. Huang e Y. Wei, "Quantitative proteomics for cancer biomarker discovery", Química combinatória e triagem de alto rendimento, vol. 15, não. 3, pp. 221–231, 2012. Ver em: Publisher Site | Google Scholar
  47. P. V & # xf6lkel, P. Le Faou e P. O. Angrand, "Interaction proteomics: characterization of protein complexes using tandem affinity purification-mass mirrometry", Transações da Sociedade Bioquímica, vol. 38, no. 4, pp. 883–887, 2010. Ver em: Publisher Site | Google Scholar
  48. S. Liang, G. Shen, X. Xu, Y. Xu e Y. Wei, "Affinity purification combinada com espectrometria de massa baseada em estratégia proteômica para estudar o complexo de proteínas de mamíferos e as interações proteína-proteína", Proteômica Atual, vol. 6, não. 1, pp. 25–31, 2009. Veja em: Publisher Site | Google Scholar
  49. S. Liang, Y. Yu, P. Yang, S. Gu, Y. Xue, e X. Chen, "Analysis of the protein complex associated with 14-3-3 epsilon by a deuterated-leucine labeling quantitativo estrategia", Journal of Chromatography B, vol. 877, no. 7, pp. 627–634, 2009. Veja em: Publisher Site | Google Scholar
  50. Y. Li, "A tecnologia de purificação de afinidade em tandem: uma visão geral", Cartas de Biotecnologia, vol. 33, não. 8, pp. 1487–1499, 2011. Ver em: Publisher Site | Google Scholar
  51. Y. Li, "Combinações de tags comumente usadas para purificação de afinidade em tandem", Biotecnologia e Bioquímica Aplicada, vol. 55, não. 2, pp. 73–83, 2010. Ver em: Publisher Site | Google Scholar
  52. D. S. Waugh, "Uma visão geral dos reagentes enzimáticos para a remoção de marcadores de afinidade", Expressão e purificação de proteínas, vol. 80, não. 2, pp. 283–293, 2011. Ver em: Publisher Site | Google Scholar
  53. A. Charlton e M. Zachariou, "Remoção de marca por clivagem específica do local de proteínas de fusão recombinantes", Métodos em Biologia Molecular, vol. 681, pp. 349-367, 2011. Ver em: Google Scholar
  54. R. J. Jenny, K. G. Mann e R. L. Lundblad, "Uma revisão crítica dos métodos de clivagem de proteínas de fusão com trombina e fator Xa", Expressão e purificação de proteínas, vol. 31, nº 1, pp. 1–11, 2003. Ver em: Publisher Site | Google Scholar
  55. L. A. Collins-Racle, J. M. McColgan, K. L. Grant, E. A. DiBlasio-Smith, J. M. McCoy e E. R. LaVallie, "Production of recombinant bovine enterokinase catalytic subunit in Escherichia coli usando o novo parceiro de fusão secretora DsbA, ” Biotecnologia, vol. 13, não. 9, pp. 982–987, 1995. Ver em: Publisher Site | Google Scholar
  56. A. Hillar, G. Otulakowski e H. O. Brodovich, "Purificação e caracterização de uma prohaptoglobina de rato recombinante expressa em células de inseto Sf9 infectadas com baculovírus", Expressão e purificação de proteínas, vol. 55, não. 2, pp. 246–256, 2007. Ver em: Publisher Site | Google Scholar
  57. O. W. Liew, J. P. C. Chong, T. G. Yandle, e S. O. Brennan, "Preparation of recombinant thioredoxin fused N-terminal proCNP: analysis of enterokinase cleavage products revela new enterokinase cleavage sites," Expressão e purificação de proteínas, vol. 41, no. 2, pp. 332–340, 2005. Ver em: Publisher Site | Google Scholar
  58. S. I. Choi, H. W. Song, J. W. Moon, e B. L. Seong, "Recombinant enterokinase light chain with affinity tag: expression from Saccharomyces cerevisiae e suas utilidades na tecnologia de proteína de fusão, ” Biotecnologia e Bioengenharia, vol. 75, não. 6, pp. 718–724, 2001. Ver em: Publisher Site | Google Scholar
  59. C. C. Hung e S. H. Chiou, "Expression of a kallikrein-like protease from the snake venom: engineering of autocatalytic site in the fusion protein to facilitar protein reolding," Comunicações de pesquisa bioquímicos e biofísicos, vol. 275, no. 3, pp. 924–930, 2000. Ver em: Publisher Site | Google Scholar
  60. A. Light e H. Janska, "Enterokinase (enteropeptidase): aspectos comparativos", Tendências em Ciências Bioquímicas, vol. 14, não. 3, pp. 110-112, 1989. Ver em: Google Scholar
  61. O. W. Liew, P. C. J. Chong, Y. Z. Lim et al., "Um motivo SRLLR a jusante da ligação cindível aumenta a eficiência de clivagem da enterocinase", Biochimie, vol. 89, não. 1, pp. 21–29, 2007. Ver em: Publisher Site | Google Scholar
  62. T. Hosfield e Q. Lu, "Influência do resíduo de aminoácido a jusante de (Asp) 4Lys na clivagem de enterocinase de uma proteína de fusão", Bioquímica Analítica, vol. 269, no. 1, pp. 10–16, 1999. Ver em: Publisher Site | Google Scholar
  63. S. H. Shahravan, X. Qu, I. S. Chan, e J. A. Shin, "Enhancing the specificity of the enterokinase cleavage reaction to promot eficiente clivage of a fusion tag", Expressão e purificação de proteínas, vol. 59, nº 2, pp. 314–319, 2008. Ver em: Publisher Site | Google Scholar
  64. J. Jesty e Y. Nemerson, "Theativation of bovine coagulation factor X", Métodos em Enzimologia, vol. 45, pp. 95–107, 1976. Veja em: Publisher Site | Google Scholar
  65. L. Aurell, P. Friberger, G. Karlsson e G. Claeson, "Um novo substrato peptídico cromogênico sensível e altamente específico para o fator X (a)," Trombose Research, vol. 11, não. 5, pp. 595–609, 1977. Ver em: Google Scholar
  66. D. Eaton, H. Rodriguez e G. A. Vehar, “Proteolytic processing of human factor VIII. Correlação de clivagens específicas por trombina, fator Xa e proteína C ativada com ativação e inativação da atividade coagulante do fator VIII, ” Bioquímica, vol. 25, não. 2, pp. 505-512, 1986. Ver em: Google Scholar
  67. R. B. Kapust, J. T & # xf6zs & # xe9r, T. D. Copeland, e D. S. Waugh, "The P1 & # x2032 specificity of smoking etch virus protease", Comunicações de pesquisa bioquímicos e biofísicos, vol. 294, no. 5, pp. 949–955, 2002. Ver em: Publisher Site | Google Scholar
  68. B. A. Frankel, R. G. Kruger, D. E. Robinson, N. L. Kelleher e D. G. McCafferty, “Staphylococcus aureus sortase transpeptidase SrtA: visão sobre o mecanismo cinético e evidências de um mecanismo catalítico de protonação reversa, ” Bioquímica, vol. 44, não. 33, pp. 11188–11200, 2005. Ver em: Publisher Site | Google Scholar
  69. X. Huang, A. Aulabaugh, W. Ding et al., "Mecanismo cinético de Staphylococcus aureus sortase SrtA, ” Bioquímica, vol. 42, não. 38, pp. 11307–11315, 2003. Veja em: Publisher Site | Google Scholar
  70. U. Ilangovan, H. Ton-That, J. Iwahara, O. Schneewind, e R. T. Clubb, "Structure of sortase, the transpeptidase that anchors protein to the cell wall of Staphylococcus aureus,” Anais da Academia Nacional de Ciências dos Estados Unidos da América, vol. 98, não. 11, pp. 6056–6061, 2001. Ver em: Publisher Site | Google Scholar
  71. M. Steinhagen, K. Zunker, K. Nordsieck, e A. G. Beck-Sickinger, "Modificação em grande escala de biomoléculas usando sortase A imobilizada de Staphylococcus aureus,” Química Bioorgânica e Medicinal, vol. 21, não. 12, pp. 3504–3510, 2013. Veja em: Publisher Site | Google Scholar
  72. P. A. Walker, L. E. Leong, P. W. P. Ng et al., "Efficient and rapid affinity purification of protein using recombinant fusion proteases", Biotecnologia, vol. 12, não. 6, pp. 601–605, 1994. Veja em: Publisher Site | Google Scholar
  73. M. G. Cordingley, P. L. Callahan, V. V. Sardana, V. M. Garsky e R. J. Colonno, "Substrate requirements of human rhinovirus 3C protease for peptide clivage in vitro", The Journal of Biological Chemistry, vol. 265, no. 16, pp. 9062–9065, 1990. Ver em: Google Scholar
  74. S. Chong, Y. Shao, H. Paulus, J. Benner, F. B. Perler e M. Xu, "Protein splicing envolvendo o Saccharomyces cerevisiae VMA intein: as etapas na via de splicing, reações colaterais que levam à clivagem de proteínas e o estabelecimento de um sistema de splicing in vitro ”, The Journal of Biological Chemistry, vol. 271, no. 36, pp. 22159–22168, 1996. Ver em: Publisher Site | Google Scholar
  75. F. B. Perler, E. O. Davis, G. E. Dean et al., "Protein splicing elements: inteins and exteins & # x2014a definição de termos e nomenclatura recomendada," Pesquisa de ácidos nucléicos, vol. 22, não. 7, pp. 1125–1127, 1994. Ver em: Google Scholar
  76. Y. Li, "Self-cleaving fusion tags for recombinant protein production," Cartas de Biotecnologia, vol. 33, não. 5, pp. 869–881, 2011. Ver em: Publisher Site | Google Scholar
  77. B. A. Fong, W. Wu e D. W. Wood, "O papel potencial das etiquetas de purificação autoclaváveis ​​em processos em escala comercial", Tendências em Biotecnologia, vol. 28, não. 5, pp. 272–279, 2010. Ver em: Publisher Site | Google Scholar
  78. M. R. Banki e D. W. Wood, "Inteins and affinity resin substitutes for protein purification and scale up", Fábricas de células microbianas, vol. 4, artigo 32, 2005. Ver em: Site da Editora | Google Scholar
  79. T. Keates, C. D. O. Cooper, P. Savitsky et al., "Expressing the human proteome for affinity proteomics: optimizing expression of soluble protein domínios and in vivo biotinylation", Nova Biotecnologia, vol. 29, nº 5, pp. 515–525, 2012. Ver em: Publisher Site | Google Scholar

Direito autoral

Copyright & # xa9 2013 Xinyu Zhao et al. Este é um artigo de acesso aberto distribuído sob a Licença de Atribuição Creative Commons, que permite o uso irrestrito, distribuição e reprodução em qualquer meio, desde que o trabalho original seja devidamente citado.


Histórico de mudanças

Alberts, B. A célula como uma coleção de máquinas de proteínas: preparando a próxima geração de biólogos moleculares. Célula 92, 291–294 (1998).

Papin, J.A., Hunter, T., Palsson, B.O. & amp Subramaniam, S. Reconstrução de redes de sinalização celular e análise de suas propriedades. Nat. Rev. Mol. Cell Biol. 6, 99–111 (2005).

Bauch, A. & amp Superti-Furga, G. Charting protein complexes, signaling pathways, and networks in the immun system. Immunol. Rev. 210, 187–207 (2006).

Hinsby, A.M. et al. Uma fiação do nucléolo humano. Mol. Célula 22, 285–295 (2006).

Fox, A.H. & amp Lamond, A.I. Processos nucleares controlados por máquinas moleculares. Genome Biol. 3 REPORTS4016 (2002).

Aebersold, R. & amp Mann, M. Mass espectrometria baseada em proteomics. Natureza 422, 198–207 (2003).

Puig, O. et al. O método de purificação por afinidade em tandem (TAP): um procedimento geral de purificação de complexo de proteínas. Métodos 24, 218–229 (2001).

Rigaut, G. et al. Um método genérico de purificação de proteínas para caracterização de complexos de proteínas e exploração de proteomas. Nat. Biotechnol. 17, 1030–1032 (1999).

Gavin, A.C. et al. Organização funcional do proteoma de levedura por análise sistemática de complexos de proteínas. Natureza 415, 141–147 (2002).

Gavin, A.C. et al. A pesquisa do proteoma revela a modularidade da maquinaria da célula de levedura. Natureza 440, 631–636 (2006).

Ho, Y. et al. Identificação sistemática de complexos de proteínas em Saccharomyces cerevisiae por espectrometria de massa. Natureza 415, 180–183 (2002).

Bouwmeester, T. et al. Um mapa físico e funcional da via de transdução de sinal TNF-alfa / NF-kappa B humano. Nat. Cell Biol. 6, 97–105 (2004).

Butland, G. et al. Rede de interação contendo complexos de proteínas conservadas e essenciais em Escherichia coli. Natureza 433, 531–537 (2005).

Brajenovic, M., Joberty, G., Kuster, B., Bouwmeester, T. & amp Drewes, G. A análise proteômica abrangente de complexos de proteína Par humana revela uma rede de proteínas interconectadas. J. Biol. Chem. 279, 12804–12811 (2004).

Terpe, K. Visão geral das fusões de proteína tag: dos fundamentos moleculares e bioquímicos aos sistemas comerciais. Appl. Microbiol. Biotechnol. 60, 523–533 (2003).

Ghosh, S. & amp Karin, M. Peças ausentes no quebra-cabeça NF-kappaB. Célula 109, S81 – S96 (2002).

Sjobring, U., Bjorck, L. & amp Kastern, W. Streptococcal protein G. Gene structure and protein binding properties. J. Biol. Chem. 266, 399–405 (1991).

Sauer-Eriksson, A.E., Kleywegt, G.J., Uhlen, M. & amp Jones, T.A. Estrutura cristalina do fragmento C2 da proteína G estreptocócica em complexo com o domínio Fc da IgG humana. Estrutura 3, 265–278 (1995).

Keefe, A.D., Wilson, D.S., Seelig, B. & amp Szostak, J.W. Purificação em uma etapa de proteínas recombinantes usando um peptídeo de ligação à estreptavidina de afinidade nanomolar, o SBP-Tag. Protein Expr. Purif. 23, 440–446 (2001).

Collis, S.J., DeWeese, T.L., Jeggo, P.A. & amp Parker, A.R. A vida e a morte do DNA-PK. Oncogene 24, 949–961 (2005).

Gottlieb, T.M. & amp Jackson, S.P. A proteína quinase dependente de DNA: requisito para extremidades de DNA e associação com antígeno Ku. Célula 72, 131–142 (1993).

Li, B. & amp Comai, L. interação funcional entre Ku e a proteína da síndrome de werner no processamento final do DNA. J. Biol. Chem. 275, 28349–28352 (2000).

Aoki, Y., Zhao, G., Qiu, D., Shi, L. & amp Kao, P.N. O regulador transcricional de caixa de purina sensível a CsA em células epiteliais brônquicas contém NF45, NF90 e Ku. Sou. J. Physiol. 275, L1164 – L1172 (1998).

Crevel, G., Ivetic, A., Ohno, K., Yamaguchi, M. & amp Cotterill, S. Análise do vizinho mais próximo de complexos de proteína MCM em Drosophila melanogaster. Nucleic Acids Res. 29, 4834–4842 (2001).

Fouraux, M.A., Bouvet, P., Verkaart, S., van Venrooij, W.J. & amp Pruijn, G.J. Nucleolina associa-se a um subconjunto de complexos de ribonucleoproteína Ro humana. J. Mol. Biol. 320, 475–488 (2002).

Park, J., Wood, M.A. & amp Cole, M.D. BAF53 forma complexos nucleares distintos e funciona como um cofator nuclear crítico de interação com c-Myc para a transformação oncogênica. Mol. Célula. Biol. 22, 1307–1316 (2002).

Krogan, N.J. et al. Panorama global de complexos de proteínas na levedura Saccharomyces cerevisiae. Natureza 440, 637–643 (2006).

Brown, D. & amp Superti-Furga, G. Rediscovering the sweet spot in drug discovery. Drug Discov. Hoje 8, 1067–1077 (2003).

Fishman, M.C. & amp Porter, J.A. Produtos farmacêuticos: uma nova gramática para a descoberta de medicamentos. Natureza 437, 491–493 (2005).

Cheeseman, I.M. & amp Desai, A. Uma abordagem combinada para a localização e purificação por afinidade em tandem de complexos de proteínas de metazoários. Sci. STKE 2005, pl1 (2005).

Bertwistle, D., Sugimoto, M. & amp Sherr, C.J. Interações físicas e funcionais da proteína supressora de tumor Arf com nucleofosmina / B23. Mol. Célula. Biol. 24, 985–996 (2004).

Canton, D.A. et al. A proteína CKIP-1 contendo o domínio de homologia da pleckstrina está envolvida na regulação da morfologia celular e do citoesqueleto de actina e na interação com a proteína capeadora de actina. Mol. Célula. Biol. 25, 3519–3534 (2005).

Hacker, H. et al. Especificidade na sinalização do receptor Toll-like por meio de funções efetoras distintas de TRAF3 e TRAF6. Natureza 439, 204–207 (2006).

Naviaux, R.K., Costanzi, E., Haas, M. & amp Verma, I.M. The pCL vector system: rapid production of helper-free, high-titer, recombinant retrovirus. J. Virol. 70, 5701–5705 (1996).

Kinsella, T.M. & amp Nolan, G.P. Os vetores episomais produzem rápida e estavelmente retrovírus recombinantes de alto título. Zumbir. Gene Ther. 7, 1405–1413 (1996).


7.25F: Purificando Proteínas por Tag de Afinidade - Biologia

um Departamento de Engenharia Química, Hacettepe University, Ancara, Turquia
O email: [email protected]
Fax: +90-312-299-21-24
Tel: +90-312-297-74-00

b Departamento de Biologia Médica e Genética, Gazi University, Ancara, Turquia

c Departamento de Biologia Médica, İstanbul Medeniyet University, İstanbul, Turquia

d Instituto de Ciência, Divisão de Bioengenharia, Universidade Hacettepe, Ancara, Turquia

e Divisão de Nanotecnologia e Nanomedicina, Hacettepe University, Ancara, Turquia

Resumo

Um sorvente magnético com comportamento magnético estável e superior foi desenvolvido para purificação de proteína marcada com His por cromatografia de afinidade com metal imobilizado (IMAC). Microesferas de sílica magnética, monodispersa e porosa de 6 μm de tamanho, com distribuição de tamanho de poro bimodal, incluindo compartimentos mesoporoso e macroporoso, foram sintetizadas como o material de base por um protocolo de hidrólise e condensação de amp. As microesferas magnéticas foram funcionalizadas com ácido iminodiacético (IDA) e Ni 2+ íons foram ligados às microesferas por formação de quelato de metal através da grupos carboxila. A magnetização de saturação e o conteúdo de carboxil de microesferas magnéticas de sílica ligadas a IDA foram determinados como 22,1 emu g −1 e 19 mmol IDA g −1 microesferas, respectivamente. Uma resposta magnética superior em relação aos sorventes IMAC atualmente disponíveis na forma de nanopartículas magnéticas compostas foi obtida com o sorvente proposto. O sorvente magnético foi utilizado para o isolamento da proteína fluorescente verde marcada com His (GFP) de E. coli lisado em lote. A adsorção de GFP de equilíbrio máximo foi ca. 87 mg de GFP por g de sorvente. O GFP foi isolado com alta seletividade (& gt95% de pureza) e o isolamento rende até 68%, alterando a concentração do sorvente magnético. O desempenho de isolamento superior do sorvente foi explicado pela presença de uma estrutura de poro bimodal incluindo ambos os macroporos facilitando a difusão intraparticular de GFP e os mesoporos servindo uma grande área de superfície para estacionamento e adsorção de GFP nas microesferas.


Purificação de proteína marcada com GST

Como purificar proteínas de fusão GST

Para gerar construtos que expressam proteínas de fusão GST, as sequências que codificam para a proteína de interesse podem ser inseridas em vetores comercialmente disponíveis. Além de seu uso para purificação por afinidade, a tag GST é frequentemente utilizada nos chamados experimentos pull-down para investigar as interações proteína-proteína.

A escala de purificação de proteínas marcadas com GST depende da quantidade de proteína na preparação. Um tamanho de coluna e capacidade de ligação total devem ser escolhidos para coincidir aproximadamente com a quantidade de proteína a ser purificada. Muito poucas proteínas não marcadas são normalmente retidas na resina se a proteína alvo ocupar quase todos os locais de ligação de glutationa disponíveis (locais de fusão GST). Se muita matriz for usada, outras proteínas podem se ligar de forma não específica a locais não ocupados.

Na purificação da proteína de fusão GST, as proteínas marcadas com GST contidas em um lisado limpo ligam-se à glutationa imobilizada (GSH, Bind). E as proteínas não vinculantes são lavadas da matriz (Wash) e as proteínas de fusão GST ligadas eluídas do suporte pela adição de glutationa reduzida em excesso (Eluto).

Purificação de proteína de fusão GST com cromatografia de afinidade

A cromatografia de afinidade é um dos tipos mais seletivos de cromatografia e pode ser uma técnica muito útil para a purificação de proteínas. Um método conveniente de expressão de proteína e purificação subsequente é fundir uma proteína com um domínio de glutationa-S-transferase (GST). A estratégia geral de purificação é, portanto, ligar a proteína de fusão GST em uma coluna de glutationa imobilizada, lavar todas as outras coisas e, em seguida, eluir a proteína.

Existem quatro etapas principais para purificar uma proteína de fusão GST:
1. Soluções para preparar o tampão A para a coluna de glutationa
2. Purificação da coluna de glutationa
3. Avaliação da purificação
4. Remoção de glutationa em uma coluna Nap-10

Além da purificação por afinidade, outras aplicações para proteínas de fusão marcadas com GST são possíveis com o auxílio de químicas de ligante de glutationa ou anticorpos específicos para marcação de GST, tais como Revestimento de microplaca, pull-down de interação de proteínas e ELISA ou Western blot.


Resumo

Ao longo de sua vida celular, os transcritos de RNA são ligados a proteínas, desempenhando papéis cruciais no metabolismo, tráfego e função do RNA. Apesar da importância dessas interações, identificar as proteínas que interagem com um RNA de interesse em células de mamíferos representa um grande desafio na biologia do RNA. Aproveitando a capacidade de rotular especificamente e covalentemente um RNA de interesse usando E. coli tRNA guanina transglicosilase e um substrato de nucleobase não natural, estabelecemos a identificação de interações RNA-proteína e o enriquecimento seletivo de RNA celular em sistemas de mamíferos. Demonstramos a utilidade desta abordagem através da identificação de parceiros de ligação conhecidos de 7SK snRNA via espectrometria de massa. Através de uma mutação mínima de 4 nucleotídeos do RNA não codificador longo HOTAIR, a biotinilação enzimática permite a identificação de supostos parceiros de ligação HOTAIR em células de câncer de mama MCF7 que sugerem novas vias potenciais para a função oncogênica. Além disso, usando sequenciamento de RNA e qPCR, estabelecemos que uma variante de enzima projetada atinge altos níveis de seletividade de marcação contra o transcriptoma humano, permitindo o enriquecimento de 145 vezes do RNA celular diretamente de lisados ​​de células de mamíferos. A flexibilidade e amplitude desta abordagem sugere que este sistema poderia ser rotineiramente aplicado à caracterização funcional do RNA, expandindo enormemente a caixa de ferramentas disponível para estudar a biologia do RNA de mamíferos.